- Recombinant Human Peroxisomal membrane protein PMP34 (SLC25A17)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1005435
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 34,567 Da
- E Coli or Yeast
- 1-307
- solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
- PMP34
- Peroxisomal membrane protein PMP34 (SLC25A17)
Sequence
MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKRAHQH